Lineage for d5m9xb2 (5m9x B:435-504)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400933Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2400934Protein automated matches [226835] (35 species)
    not a true protein
  7. 2400969Species Bifidobacterium adolescentis [TaxId:1680] [255184] (4 PDB entries)
  8. 2400974Domain d5m9xb2: 5m9x B:435-504 [343101]
    Other proteins in same PDB: d5m9xb1
    automated match to d1r7aa1
    complexed with 7kp

Details for d5m9xb2

PDB Entry: 5m9x (more details), 2.35 Å

PDB Description: structure of sucrose phosphorylase from bifidobacterium adolescentis bound to glycosylated resveratrol
PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d5m9xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m9xb2 b.71.1.0 (B:435-504) automated matches {Bifidobacterium adolescentis [TaxId: 1680]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

SCOPe Domain Coordinates for d5m9xb2:

Click to download the PDB-style file with coordinates for d5m9xb2.
(The format of our PDB-style files is described here.)

Timeline for d5m9xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m9xb1