Lineage for d5mxca1 (5mxc A:1-312)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065738Superfamily b.68.8: Fucose-specific lectin [89372] (2 families) (S)
    automatically mapped to Pfam PF07938
  5. 2065739Family b.68.8.1: Fucose-specific lectin [89373] (2 protein domains)
  6. 2299792Protein automated matches [343093] (1 species)
    not a true protein
  7. 2299793Species Aleuria aurantia [TaxId:5188] [343094] (1 PDB entry)
  8. 2299794Domain d5mxca1: 5mxc A:1-312 [343095]
    Other proteins in same PDB: d5mxca2
    automated match to d1iuca_
    complexed with gol, mfu; mutant

Details for d5mxca1

PDB Entry: 5mxc (more details), 1.14 Å

PDB Description: aleuria aurantia lectin (aal) n224q mutant in complex with alpha- methyl-l-fucoside
PDB Compounds: (A:) fucose-specific lectin

SCOPe Domain Sequences for d5mxca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mxca1 b.68.8.1 (A:1-312) automated matches {Aleuria aurantia [TaxId: 5188]}
pteflytskiaaiswaatggrqqrvyfqdlngkireaqrggdnpwtggssqnvigeaklf
splaavtwksaqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalqw
ggsesappnirvyyqksngsgssiheyvwsgkwtagasfgstvpgtgigataigpgrlri
yyqatdnkirehcwdsnswyvggfsasasagvsiaaiswgstpqirvywqkgreelyeaa
yggswntpgqikdasrptpslpdtfiaanssgnidisvffqasgvslqqwqwisgkgwsi
gavvptgtpagw

SCOPe Domain Coordinates for d5mxca1:

Click to download the PDB-style file with coordinates for d5mxca1.
(The format of our PDB-style files is described here.)

Timeline for d5mxca1:

  • d5mxca1 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21

View in 3D
Domains from same chain:
(mouse over for more information)
d5mxca2