Lineage for d5m3ua_ (5m3u A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483248Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2483249Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2483250Family c.86.1.1: Phosphoglycerate kinase [53749] (2 protein domains)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2483285Protein automated matches [190709] (4 species)
    not a true protein
  7. 2483289Species Human (Homo sapiens) [TaxId:9606] [188478] (24 PDB entries)
  8. 2483310Domain d5m3ua_: 5m3u A: [343091]
    automated match to d3c3ba_
    complexed with 3pg, adp, mg; mutant

Details for d5m3ua_

PDB Entry: 5m3u (more details), 1.81 Å

PDB Description: the x-ray structure of human v216f phosphoglycerate kinase 1 mutant
PDB Compounds: (A:) Phosphoglycerate kinase 1

SCOPe Domain Sequences for d5m3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m3ua_ c.86.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlm
shlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillen
lrfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnl
pqkaggflmkkelnyfakalesperpflailggakfadkiqlinnmldkvnemiigggma
ftflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqa
tvasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvk
atsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni

SCOPe Domain Coordinates for d5m3ua_:

Click to download the PDB-style file with coordinates for d5m3ua_.
(The format of our PDB-style files is described here.)

Timeline for d5m3ua_: