Lineage for d5m6ka_ (5m6k A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063481Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2063482Protein automated matches [190698] (21 species)
    not a true protein
  7. 2063570Species Rhodnius prolixus [TaxId:13249] [193297] (10 PDB entries)
  8. 2299780Domain d5m6ka_: 5m6k A: [343081]
    automated match to d4xmea_
    complexed with hem, imd; mutant

Details for d5m6ka_

PDB Entry: 5m6k (more details), 1.6 Å

PDB Description: crystal structure of nitrophorin 7 e27v mutant from rhodnius prolixus with imidazole
PDB Compounds: (A:) Nitrophorin-7

SCOPe Domain Sequences for d5m6ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m6ka_ b.60.1.0 (A:) automated matches {Rhodnius prolixus [TaxId: 13249]}
pgecsvnvipkknldkakffsgtwyvthyldmdpqatekfcfsfapresggtvkealyhf
nvdskvsfyntgtgplesngakytakfntvdkkgkeikpadekysytvtvieaakqsali
hiclqedgkdigdlysvlnrnknalpnkkikkalnkvslvltkfvvtkdldckyddkfls
swqk

SCOPe Domain Coordinates for d5m6ka_:

Click to download the PDB-style file with coordinates for d5m6ka_.
(The format of our PDB-style files is described here.)

Timeline for d5m6ka_:

  • d5m6ka_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21