Lineage for d5mi3b3 (5mi3 B:298-394)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2386873Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386874Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2386981Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2386982Protein automated matches [254425] (17 species)
    not a true protein
  7. 2387007Species Escherichia coli [TaxId:331112] [343073] (2 PDB entries)
  8. 2387009Domain d5mi3b3: 5mi3 B:298-394 [343074]
    Other proteins in same PDB: d5mi3a1, d5mi3a2, d5mi3b1, d5mi3b2
    automated match to d1d8ta2
    complexed with gdp, mg

Details for d5mi3b3

PDB Entry: 5mi3 (more details), 2.8 Å

PDB Description: structure of phosphorylated translation elongation factor ef-tu from e. coli
PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d5mi3b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mi3b3 b.44.1.0 (B:298-394) automated matches {Escherichia coli [TaxId: 331112]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

SCOPe Domain Coordinates for d5mi3b3:

Click to download the PDB-style file with coordinates for d5mi3b3.
(The format of our PDB-style files is described here.)

Timeline for d5mi3b3: