Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (26 species) not a true protein |
Species Escherichia coli [TaxId:331112] [343071] (1 PDB entry) |
Domain d5mi3b2: 5mi3 B:206-297 [343072] Other proteins in same PDB: d5mi3a1, d5mi3a3, d5mi3b1, d5mi3b3 automated match to d1efca1 complexed with gdp, mg |
PDB Entry: 5mi3 (more details), 2.8 Å
SCOPe Domain Sequences for d5mi3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mi3b2 b.43.3.0 (B:206-297) automated matches {Escherichia coli [TaxId: 331112]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d5mi3b2: