Lineage for d5mi3b2 (5mi3 B:206-297)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062960Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2062961Protein automated matches [226946] (26 species)
    not a true protein
  7. 2063009Species Escherichia coli [TaxId:331112] [343071] (1 PDB entry)
  8. 2063011Domain d5mi3b2: 5mi3 B:206-297 [343072]
    Other proteins in same PDB: d5mi3a1, d5mi3a3, d5mi3b1, d5mi3b3
    automated match to d1efca1
    complexed with gdp, mg

Details for d5mi3b2

PDB Entry: 5mi3 (more details), 2.8 Å

PDB Description: structure of phosphorylated translation elongation factor ef-tu from e. coli
PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d5mi3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mi3b2 b.43.3.0 (B:206-297) automated matches {Escherichia coli [TaxId: 331112]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d5mi3b2:

Click to download the PDB-style file with coordinates for d5mi3b2.
(The format of our PDB-style files is described here.)

Timeline for d5mi3b2: