Lineage for d5mi3b1 (5mi3 B:9-205)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (29 species)
    not a true protein
  7. 2448945Species Escherichia coli [TaxId:331112] [343069] (2 PDB entries)
  8. 2448947Domain d5mi3b1: 5mi3 B:9-205 [343070]
    Other proteins in same PDB: d5mi3a2, d5mi3a3, d5mi3b2, d5mi3b3
    automated match to d1d8ta3
    complexed with gdp, mg

Details for d5mi3b1

PDB Entry: 5mi3 (more details), 2.8 Å

PDB Description: structure of phosphorylated translation elongation factor ef-tu from e. coli
PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d5mi3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mi3b1 c.37.1.8 (B:9-205) automated matches {Escherichia coli [TaxId: 331112]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

SCOPe Domain Coordinates for d5mi3b1:

Click to download the PDB-style file with coordinates for d5mi3b1.
(The format of our PDB-style files is described here.)

Timeline for d5mi3b1: