Lineage for d5mb1c_ (5mb1 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075234Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2075235Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2075236Family b.115.1.1: Calcium-mediated lectin [82027] (3 protein domains)
    automatically mapped to Pfam PF07472
  6. 2075282Protein automated matches [190094] (4 species)
    not a true protein
  7. 2274348Species Pseudomonas aeruginosa [TaxId:208963] [317649] (8 PDB entries)
  8. 2299762Domain d5mb1c_: 5mb1 C: [343063]
    automated match to d4ut5a_
    complexed with 7kt, ca, flc, ful

Details for d5mb1c_

PDB Entry: 5mb1 (more details), 1.65 Å

PDB Description: structure of the lecb lectin from pseudomonas aeruginosa strain pa14 in complex with 2,4,6-trimethylphenylsulfonamide-n-methyl-l- fucopyranoside
PDB Compounds: (C:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d5mb1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mb1c_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg

SCOPe Domain Coordinates for d5mb1c_:

Click to download the PDB-style file with coordinates for d5mb1c_.
(The format of our PDB-style files is described here.)

Timeline for d5mb1c_:

  • d5mb1c_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21