Lineage for d5mb7a_ (5mb7 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2393116Protein Endothiapepsin [50647] (1 species)
  7. 2393117Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (510 PDB entries)
  8. 2393353Domain d5mb7a_: 5mb7 A: [343047]
    automated match to d1oewa_
    complexed with 4av, gol

Details for d5mb7a_

PDB Entry: 5mb7 (more details), 1.3 Å

PDB Description: cocktail experiment b: fragments 224 and 236 at 50mm concentration
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5mb7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mb7a_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5mb7a_:

Click to download the PDB-style file with coordinates for d5mb7a_.
(The format of our PDB-style files is described here.)

Timeline for d5mb7a_: