Lineage for d6bmea_ (6bme A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979527Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1979528Protein automated matches [190590] (21 species)
    not a true protein
  7. 1979567Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [269183] (2 PDB entries)
  8. 1979568Domain d6bmea_: 6bme A: [343040]
    automated match to d4xdia_
    complexed with hem, so4

Details for d6bmea_

PDB Entry: 6bme (more details), 1.9 Å

PDB Description: crystal structure of chlamydomonas reinhardtii thb4
PDB Compounds: (A:) Truncated hemoglobin 4

SCOPe Domain Sequences for d6bmea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bmea_ a.1.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
stlhaklggaaavaatvdvfykklmndpdlepffrgvdmvtliakqnrflayafgatthy
hgkdivmghahliinrglnlthfdkvaghfvdslkemgvgqelideaagvligvrplfdp
erykgkv

SCOPe Domain Coordinates for d6bmea_:

Click to download the PDB-style file with coordinates for d6bmea_.
(The format of our PDB-style files is described here.)

Timeline for d6bmea_: