SCOPe 2.08: Domain d6bmea_: 6bme A:

Lineage for d6bmea_ (6bme A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (26 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [269183] (4 PDB entries)

8. Domain d6bmea_: 6bme A: [343040]
   automated match to d4xdia_
   complexed with hem, so4

Details for d6bmea_

PDB Entry: 6bme, 1.9 Å

PDB Description: crystal structure of chlamydomonas reinhardtii thb4

PDB Compounds: (A:) Truncated hemoglobin 4

SCOPe Domain Sequences for d6bmea_:

Sequence; same for both SEQRES and ATOM records:

>d6bmea_ a.1.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
stlhaklggaaavaatvdvfykklmndpdlepffrgvdmvtliakqnrflayafgatthy
hgkdivmghahliinrglnlthfdkvaghfvdslkemgvgqelideaagvligvrplfdp
erykgkv

Timeline for d6bmea_:

• d6bmea_ first appeared in SCOPe 2.06
  
• d6bmea_ appears in SCOPe 2.07