Lineage for d5kiya3 (5kiy A:201-460)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113456Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2113662Protein Membrane fusion ATPase VCP/p97 [64038] (2 species)
  7. 2270181Species Homo sapiens [TaxId:9606] [313486] (4 PDB entries)
  8. 2299734Domain d5kiya3: 5kiy A:201-460 [343035]
    Other proteins in same PDB: d5kiya1, d5kiya2, d5kiya4
    automated match to d1e32a2
    complexed with anp, mg

Details for d5kiya3

PDB Entry: 5kiy (more details), 2.79 Å

PDB Description: p97 nd1-a232e in complex with vimp
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5kiya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kiya3 c.37.1.20 (A:201-460) Membrane fusion ATPase VCP/p97 {Homo sapiens [TaxId: 9606]}
vgyddiggcrkqlaqikemvelplrhpalfkeigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsqsn

SCOPe Domain Coordinates for d5kiya3:

Click to download the PDB-style file with coordinates for d5kiya3.
(The format of our PDB-style files is described here.)

Timeline for d5kiya3:

  • d5kiya3 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21