Lineage for d5kiya2 (5kiy A:107-200)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2510473Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2510474Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2510475Family d.31.1.1: Cdc48 domain 2-like [54586] (4 protein domains)
  6. 2510490Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2510491Species Human (Homo sapiens) [TaxId:9606] [233318] (12 PDB entries)
  8. 2510515Domain d5kiya2: 5kiy A:107-200 [343034]
    Other proteins in same PDB: d5kiya1, d5kiya3, d5kiya4
    automated match to d1e32a3
    complexed with anp, mg

Details for d5kiya2

PDB Entry: 5kiy (more details), 2.79 Å

PDB Description: p97 nd1-a232e in complex with vimp
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5kiya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kiya2 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOPe Domain Coordinates for d5kiya2:

Click to download the PDB-style file with coordinates for d5kiya2.
(The format of our PDB-style files is described here.)

Timeline for d5kiya2: