Lineage for d5kiya1 (5kiy A:10-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2393919Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2393982Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2394127Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 protein domains)
  6. 2394128Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species)
  7. 2394129Species Human (Homo sapiens) [TaxId:9606] [233316] (12 PDB entries)
  8. 2394153Domain d5kiya1: 5kiy A:10-106 [343033]
    Other proteins in same PDB: d5kiya2, d5kiya3, d5kiya4
    automated match to d4kdia1
    complexed with anp, mg

Details for d5kiya1

PDB Entry: 5kiy (more details), 2.79 Å

PDB Description: p97 nd1-a232e in complex with vimp
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5kiya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kiya1 b.52.2.3 (A:10-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]}
ddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavc
ivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d5kiya1:

Click to download the PDB-style file with coordinates for d5kiya1.
(The format of our PDB-style files is described here.)

Timeline for d5kiya1: