Lineage for d5mayc_ (5may C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086160Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2086161Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2086162Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 2086208Protein automated matches [190094] (4 species)
    not a true protein
  7. 2086209Species Pseudomonas aeruginosa [TaxId:208963] [317649] (8 PDB entries)
  8. 2086232Domain d5mayc_: 5may C: [343014]
    automated match to d4ut5a_
    complexed with ca, ful, pk6

Details for d5mayc_

PDB Entry: 5may (more details), 1.65 Å

PDB Description: structure of the lecb lectin from pseudomonas aeruginosa strain pa14 in complex with 2-thiophenesulfonamide-n-(beta-l-fucopyranosyl methyl)
PDB Compounds: (C:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d5mayc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mayc_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg

SCOPe Domain Coordinates for d5mayc_:

Click to download the PDB-style file with coordinates for d5mayc_.
(The format of our PDB-style files is described here.)

Timeline for d5mayc_: