Class b: All beta proteins [48724] (177 folds) |
Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) |
Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins) automatically mapped to Pfam PF07472 |
Protein automated matches [190094] (4 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208963] [317649] (8 PDB entries) |
Domain d5mayc_: 5may C: [343014] automated match to d4ut5a_ complexed with ca, ful, pk6 |
PDB Entry: 5may (more details), 1.65 Å
SCOPe Domain Sequences for d5mayc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mayc_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]} atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg
Timeline for d5mayc_: