Lineage for d5m84a_ (5m84 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528139Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2528140Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2528141Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
    automatically mapped to Pfam PF01652
  6. 2528142Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. 2528172Species Mouse (Mus musculus) [TaxId:10090] [55421] (16 PDB entries)
  8. 2528196Domain d5m84a_: 5m84 A: [343009]
    automated match to d1l8bb_
    protein/RNA complex; complexed with gol, ydz

Details for d5m84a_

PDB Entry: 5m84 (more details), 1.85 Å

PDB Description: translation initiation factor 4e in complex with (sp)-m2(7,2'o)gppspa mrna 5' cap analog
PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d5m84a_:

Sequence, based on SEQRES records: (download)

>d5m84a_ d.86.1.1 (A:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
pehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcd
yslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvc
gavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgst
tknrfvv

Sequence, based on observed residues (ATOM records): (download)

>d5m84a_ d.86.1.1 (A:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
pehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcd
yslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvc
gavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtaknrfvv

SCOPe Domain Coordinates for d5m84a_:

Click to download the PDB-style file with coordinates for d5m84a_.
(The format of our PDB-style files is described here.)

Timeline for d5m84a_: