Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225821] (6 PDB entries) |
Domain d6blra1: 6blr A:1-84 [343006] Other proteins in same PDB: d6blra2 automated match to d1f3ja2 complexed with edo |
PDB Entry: 6blr (more details), 1.96 Å
SCOPe Domain Sequences for d6blra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6blra1 d.19.1.1 (A:1-84) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg glqciaaekhnlgiltkrsnftpa
Timeline for d6blra1: