Lineage for d6eqla_ (6eql A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473281Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2473282Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2474062Family c.68.1.14: Glycogenin [75273] (2 protein domains)
  6. 2474063Protein Glycogenin [75274] (2 species)
  7. 2474064Species Human (Homo sapiens) [TaxId:9606] [189634] (14 PDB entries)
  8. 2474085Domain d6eqla_: 6eql A: [342992]
    automated match to d3u2wa_
    complexed with 2pe, edo, mn, udp; mutant

Details for d6eqla_

PDB Entry: 6eql (more details), 2.38 Å

PDB Description: crystal structure of human glycogenin-1 (gyg1) tyr195piphe mutant complexed with manganese and udp
PDB Compounds: (A:) glycogenin-1

SCOPe Domain Sequences for d6eqla_:

Sequence, based on SEQRES records: (download)

>d6eqla_ c.68.1.14 (A:) Glycogenin {Human (Homo sapiens) [TaxId: 9606]}
mtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevim
vdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdreel
saapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdir
khlpfiynlssisifsylpafkvfgasakvvhflgrvkpwnytydpktksvkseahdpnm
thpeflilwwnifttnvlpll

Sequence, based on observed residues (ATOM records): (download)

>d6eqla_ c.68.1.14 (A:) Glycogenin {Human (Homo sapiens) [TaxId: 9606]}
mtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevim
vdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdreel
saapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdir
khlpfiynlssisifsylpafkvfgasakvvhflgrvkpwnytydpktksvpnmthpefl
ilwwnifttnvlpll

SCOPe Domain Coordinates for d6eqla_:

Click to download the PDB-style file with coordinates for d6eqla_.
(The format of our PDB-style files is described here.)

Timeline for d6eqla_: