Lineage for d6en5a_ (6en5 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (49 PDB entries)
  8. 2530232Domain d6en5a_: 6en5 A: [342990]
    automated match to d5am9c_
    complexed with act, bj2, bma, cl, edo, fuc, man, mg, nag, pe3, peg, pg4, pge, xpe, zn

Details for d6en5a_

PDB Entry: 6en5 (more details), 1.75 Å

PDB Description: crystal structure a of the angiotensin-1 converting enzyme n-domain in complex with a diprolyl inhibitor.
PDB Compounds: (A:) angiotensin-converting enzyme

SCOPe Domain Sequences for d6en5a_:

Sequence, based on SEQRES records: (download)

>d6en5a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
pplpdnypeg

Sequence, based on observed residues (ATOM records): (download)

>d6en5a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
iystakvclpcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsnea
ykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryinlr
gpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeefftsle
lspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhemgh
iqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdinyl
lkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrnethfd
agakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkvlr
agssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhpplpd
nypeg

SCOPe Domain Coordinates for d6en5a_:

Click to download the PDB-style file with coordinates for d6en5a_.
(The format of our PDB-style files is described here.)

Timeline for d6en5a_: