Lineage for d6bnga1 (6bng A:5-285)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086269Protein automated matches [190083] (9 species)
    not a true protein
  7. 2299682Species Acinetobacter baumannii [TaxId:557600] [342983] (1 PDB entry)
  8. 2299687Domain d6bnga1: 6bng A:5-285 [342988]
    Other proteins in same PDB: d6bnga2
    automated match to d1g7ua_
    complexed with so4

Details for d6bnga1

PDB Entry: 6bng (more details), 2.2 Å

PDB Description: structure of 2-dehydro-3-deoxyphosphooctonate aldolase from acinetobacter baumannii
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d6bnga1:

Sequence, based on SEQRES records: (download)

>d6bnga1 c.1.10.4 (A:5-285) automated matches {Acinetobacter baumannii [TaxId: 557600]}
kpqevvrlgdiqmanhlpfvlfggmnvleskdlafeiaetyidickrldipyvfkasfdk
anrsslhsfrgpglekgiewlgdikkhfnvpiitdvhepyqaapvaevadiiqlpaflsr
qtdlveamaktqaiinikkaqflaphemrhilhkcleagndklilcergsafgynnlvvd
mlgfdimkemnvpvffdvthalqtpggrsdsaggrraqittlaragmatglaglfleshp
dpdkakcdgpsalrlsqlepflaqlkeldtlvkgfkkldth

Sequence, based on observed residues (ATOM records): (download)

>d6bnga1 c.1.10.4 (A:5-285) automated matches {Acinetobacter baumannii [TaxId: 557600]}
kpqevvrlgdiqmanhlpfvlfggmnvleskdlafeiaetyidickrldipyvfkasfdk
anrsslhsfrgpglekgiewlgdikkhfnvpiitdvhepyqaapvaevadiiqlpaflsr
qtdlveamaktqaiinikkaqflaphemrhilhkcleagndklilcergsafgynnlvvd
mlgfdimkemnvpvffdvthalqtpgggrraqittlaragmatglaglfleshpdpdkak
cdgpsalrlsqlepflaqlkeldtlvkgfkkldth

SCOPe Domain Coordinates for d6bnga1:

Click to download the PDB-style file with coordinates for d6bnga1.
(The format of our PDB-style files is described here.)

Timeline for d6bnga1:

  • d6bnga1 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21

View in 3D
Domains from same chain:
(mouse over for more information)
d6bnga2
View in 3D
Domains from other chains:
(mouse over for more information)
d6bngb_