SCOPe 2.06: Domain d6bu6a_: 6bu6 A:

Lineage for d6bu6a_ (6bu6 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)

8. Domain d6bu6a_: 6bu6 A: [342978]
   automated match to d3op5a_
   complexed with cl, e8v, gol, so4

Details for d6bu6a_

PDB Entry: 6bu6, 1.8 Å

PDB Description: crystal structure of the human vaccinia-related kinase bound to a bis- difluorophenol-aminopyridine inhibitor

PDB Compounds: (A:) Serine/threonine-protein kinase VRK1

SCOPe Domain Sequences for d6bu6a_:

Sequence; same for both SEQRES and ATOM records:

>d6bu6a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeqfavgeiitdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngp
lftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlq
kiyeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyg
layrycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghl
pwednlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyen
lrdillqglkaigskddgkldl

Timeline for d6bu6a_:

• d6bu6a_ is new in SCOPe 2.06-stable
  
• d6bu6a_ appears in SCOPe 2.07
  
• d6bu6a_ appears in the current release, SCOPe 2.08