Lineage for d6bu6a_ (6bu6 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (28 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (994 PDB entries)
  8. 2546681Domain d6bu6a_: 6bu6 A: [342978]
    automated match to d3op5a_
    complexed with cl, e8v, gol, so4

Details for d6bu6a_

PDB Entry: 6bu6 (more details), 1.8 Å

PDB Description: crystal structure of the human vaccinia-related kinase bound to a bis- difluorophenol-aminopyridine inhibitor
PDB Compounds: (A:) Serine/threonine-protein kinase VRK1

SCOPe Domain Sequences for d6bu6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bu6a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeqfavgeiitdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngp
lftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlq
kiyeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyg
layrycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghl
pwednlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyen
lrdillqglkaigskddgkldl

SCOPe Domain Coordinates for d6bu6a_:

Click to download the PDB-style file with coordinates for d6bu6a_.
(The format of our PDB-style files is described here.)

Timeline for d6bu6a_: