Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [342941] (1 PDB entry) |
Domain d6ap4j3: 6ap4 J:261-381 [342957] Other proteins in same PDB: d6ap4a4, d6ap4b4, d6ap4c4, d6ap4d4, d6ap4e4, d6ap4f4, d6ap4g4, d6ap4h4, d6ap4i4, d6ap4j4, d6ap4l4, d6ap4m4, d6ap4n4, d6ap4o4, d6ap4p4 automated match to d4tr8a3 complexed with mg |
PDB Entry: 6ap4 (more details), 2.95 Å
SCOPe Domain Sequences for d6ap4j3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ap4j3 d.131.1.0 (J:261-381) automated matches {Acinetobacter baumannii [TaxId: 470]} rrviprggdkhvlighdvfkqslqrvailsneklrgvflnfnqdslqlrannpeqdeaie dlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanqsvlvqdpahpdqtyvvmpm r
Timeline for d6ap4j3:
View in 3D Domains from other chains: (mouse over for more information) d6ap4a1, d6ap4a2, d6ap4a3, d6ap4a4, d6ap4b1, d6ap4b2, d6ap4b3, d6ap4b4, d6ap4c1, d6ap4c2, d6ap4c3, d6ap4c4, d6ap4d1, d6ap4d2, d6ap4d3, d6ap4d4, d6ap4e1, d6ap4e2, d6ap4e3, d6ap4e4, d6ap4f1, d6ap4f2, d6ap4f3, d6ap4f4, d6ap4g1, d6ap4g2, d6ap4g3, d6ap4g4, d6ap4h1, d6ap4h2, d6ap4h3, d6ap4h4, d6ap4i1, d6ap4i2, d6ap4i3, d6ap4i4, d6ap4k1, d6ap4k2, d6ap4k3, d6ap4l1, d6ap4l2, d6ap4l3, d6ap4l4, d6ap4m1, d6ap4m2, d6ap4m3, d6ap4m4, d6ap4n1, d6ap4n2, d6ap4n3, d6ap4n4, d6ap4o1, d6ap4o2, d6ap4o3, d6ap4o4, d6ap4p1, d6ap4p2, d6ap4p3, d6ap4p4 |