Lineage for d6bn5b1 (6bn5 B:4-110)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530930Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2530931Protein automated matches [190561] (4 species)
    not a true protein
  7. 2530932Species Human (Homo sapiens) [TaxId:9606] [187549] (57 PDB entries)
  8. 2530983Domain d6bn5b1: 6bn5 B:4-110 [342934]
    Other proteins in same PDB: d6bn5a3, d6bn5b2
    automated match to d2shpa2
    complexed with dzj

Details for d6bn5b1

PDB Entry: 6bn5 (more details), 2.22 Å

PDB Description: non-receptor protein tyrosine phosphatase shp2 f285s in complex with allosteric inhibitor jlr-2
PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6bn5b1:

Sequence, based on SEQRES records: (download)

>d6bn5b1 d.93.1.0 (B:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
dlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

Sequence, based on observed residues (ATOM records): (download)

>d6bn5b1 d.93.1.0 (B:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrwfhpnitgveaenllltrgvdgsflarpspgdftlsvrrngavthikiqntgdyydly
ggekfatlaelvqyymehelkyplncadpe

SCOPe Domain Coordinates for d6bn5b1:

Click to download the PDB-style file with coordinates for d6bn5b1.
(The format of our PDB-style files is described here.)

Timeline for d6bn5b1: