Lineage for d5wt5b_ (5wt5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132544Species Helicobacter pylori [TaxId:85962] [188666] (5 PDB entries)
  8. 2299632Domain d5wt5b_: 5wt5 B: [342933]
    automated match to d4eb5a_
    complexed with hcs, ipa

Details for d5wt5b_

PDB Entry: 5wt5 (more details), 1.9 Å

PDB Description: l-homocysteine-bound nifs from helicobacter pylori
PDB Compounds: (B:) Cysteine desulfurase IscS

SCOPe Domain Sequences for d5wt5b_:

Sequence, based on SEQRES records: (download)

>d5wt5b_ c.67.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
vqriyldnnattridpkvkeimdpflrdhygnpsslhqfgtethpaiaealdklykgina
rdiddviitscatesnnwvlkgvyfdeclkkgknhivttvaehpavrstcnfleslgvev
tylpinehgsitaeqvreaitektalvsvmwannetglifpieeigaickekgvlfhtda
vqaigkipvdvlkanadflsfsahkfhgpkgigglyirsgvgltplfhggehmngrrsgt
lnvpyivgmgeamklavehldyekevvgklrdkleeallkipdvmvvgdrihrvpnttlv
svrgiegeamlwdlnrsniaastgsacasedleanpvmvaigaskelahtairlslsrfn
teaeidktievfsqaavrlrnis

Sequence, based on observed residues (ATOM records): (download)

>d5wt5b_ c.67.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
vqriyldnnattridpkvkeimdpflrdhygnpsslhqfgtethpaiaealdklykgina
rdiddviitscatesnnwvlkgvyfdeclkkgknhivttvaehpavrstcnfleslgvev
tylpinehgsitaeqvreaitektalvsvmwannetglifpieeigaickekgvlfhtda
vqaigkipvdvlkanadflsfsahkfhgpkgigglyirsgvgltplfhggehmngrrsgt
lnvpyivgmgeamklavehldyekevvgklrdkleeallkipdvmvvgdrihrvpnttlv
svrgiegeamlwdlnrsniaastgsacahtairlslsrfnteaeidktievfsqaavrlr
nis

SCOPe Domain Coordinates for d5wt5b_:

Click to download the PDB-style file with coordinates for d5wt5b_.
(The format of our PDB-style files is described here.)

Timeline for d5wt5b_:

  • d5wt5b_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-14