Lineage for d6bn5a3 (6bn5 A:219-521)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2454684Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 protein domains)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2454892Protein automated matches [190252] (4 species)
    not a true protein
  7. 2454893Species Human (Homo sapiens) [TaxId:9606] [187034] (35 PDB entries)
  8. 2454927Domain d6bn5a3: 6bn5 A:219-521 [342926]
    Other proteins in same PDB: d6bn5a1, d6bn5a2, d6bn5b1
    automated match to d2shpa1
    complexed with dzj

Details for d6bn5a3

PDB Entry: 6bn5 (more details), 2.22 Å

PDB Description: non-receptor protein tyrosine phosphatase shp2 f285s in complex with allosteric inhibitor jlr-2
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6bn5a3:

Sequence, based on SEQRES records: (download)

>d6bn5a3 c.45.1.2 (A:219-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr
yknilpsdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv
ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
qhy

Sequence, based on observed residues (ATOM records): (download)

>d6bn5a3 c.45.1.2 (A:219-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaiesrvrelsqgfweefetlqqqeckllysrkegqrqenknknryknilpsdhtr
vvlhsdyinaniimpksyiatqgclqntvndfwrmvfqensrvivmttkevergkskcvk
ywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtwpdhgvp
sdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiirekgvdcdid
vpktiqmvrsqrsgmvqteaqyrfiymavqhy

SCOPe Domain Coordinates for d6bn5a3:

Click to download the PDB-style file with coordinates for d6bn5a3.
(The format of our PDB-style files is described here.)

Timeline for d6bn5a3: