Lineage for d6bn5a2 (6bn5 A:111-218)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184972Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2184973Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2185424Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2185425Protein automated matches [190561] (4 species)
    not a true protein
  7. 2185426Species Human (Homo sapiens) [TaxId:9606] [187549] (49 PDB entries)
  8. 2299624Domain d6bn5a2: 6bn5 A:111-218 [342925]
    Other proteins in same PDB: d6bn5a3, d6bn5b2
    automated match to d2shpa3
    complexed with dzj

Details for d6bn5a2

PDB Entry: 6bn5 (more details), 2.22 Å

PDB Description: non-receptor protein tyrosine phosphatase shp2 f285s in complex with allosteric inhibitor jlr-2
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6bn5a2:

Sequence, based on SEQRES records: (download)

>d6bn5a2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Sequence, based on observed residues (ATOM records): (download)

>d6bn5a2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaekllthgsflvrepgdfvlsvrtgdskvthvmircqelkydvgggerf
dsltdlvehykknpmvetlgtvlqlkqpnt

SCOPe Domain Coordinates for d6bn5a2:

Click to download the PDB-style file with coordinates for d6bn5a2.
(The format of our PDB-style files is described here.)

Timeline for d6bn5a2:

  • d6bn5a2 appears in periodic updates to SCOPe 2.06 starting on 2017-12-14