Lineage for d5xmfb_ (5xmf B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2348365Protein beta2-microglobulin [88600] (6 species)
  7. 2348366Species Cat (Felis catus) [TaxId:9685] [342900] (2 PDB entries)
  8. 2348367Domain d5xmfb_: 5xmf B: [342913]
    Other proteins in same PDB: d5xmfa1, d5xmfa2
    automated match to d1duzb_

Details for d5xmfb_

PDB Entry: 5xmf (more details), 2.1 Å

PDB Description: crystal structure of feline mhc class i for 2,1 angstrom
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d5xmfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xmfb_ b.1.1.2 (B:) beta2-microglobulin {Cat (Felis catus) [TaxId: 9685]}
mvqhspkvqvysrhpaengkpnflncyvsgfhppqiditlmkngkkmeaeqtdlsfnrdw
tfyllvhteftptvedeyscqvnhttlsepkvvkwdrdm

SCOPe Domain Coordinates for d5xmfb_:

Click to download the PDB-style file with coordinates for d5xmfb_.
(The format of our PDB-style files is described here.)

Timeline for d5xmfb_: