Lineage for d5xzra3 (5xzr A:219-534)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2455001Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2455002Protein automated matches [190475] (9 species)
    not a true protein
  7. 2455014Species Human (Homo sapiens) [TaxId:9606] [187400] (118 PDB entries)
  8. 2455179Domain d5xzra3: 5xzr A:219-534 [342911]
    Other proteins in same PDB: d5xzra1, d5xzra2
    automated match to d2b3oa3
    complexed with 8j6; mutant

Details for d5xzra3

PDB Entry: 5xzr (more details), 2.8 Å

PDB Description: the atomic structure of shp2 e76a mutant in complex with allosteric inhibitor 9b
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d5xzra3:

Sequence, based on SEQRES records: (download)

>d5xzra3 c.45.1.0 (A:219-534) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr
yknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv
ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
qhyietlqrrieeeqk

Sequence, based on observed residues (ATOM records): (download)

>d5xzra3 c.45.1.0 (A:219-534) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklaekvkqgfweefetlqqqeckllysrkegqrqenknknrykn
ilpfdhtrvvlhdgdpnepvsdyinaniimpksyiatqgclqntvndfwrmvfqensrvi
vmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgnter
tvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfivid
ilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrieeeq
k

SCOPe Domain Coordinates for d5xzra3:

Click to download the PDB-style file with coordinates for d5xzra3.
(The format of our PDB-style files is described here.)

Timeline for d5xzra3: