Lineage for d5xzra2 (5xzr A:111-218)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184972Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2184973Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2185424Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2185425Protein automated matches [190561] (4 species)
    not a true protein
  7. 2185426Species Human (Homo sapiens) [TaxId:9606] [187549] (49 PDB entries)
  8. 2299609Domain d5xzra2: 5xzr A:111-218 [342910]
    Other proteins in same PDB: d5xzra3
    automated match to d3ps5a2
    complexed with 8j6; mutant

Details for d5xzra2

PDB Entry: 5xzr (more details), 2.8 Å

PDB Description: the atomic structure of shp2 e76a mutant in complex with allosteric inhibitor 9b
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d5xzra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xzra2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

SCOPe Domain Coordinates for d5xzra2:

Click to download the PDB-style file with coordinates for d5xzra2.
(The format of our PDB-style files is described here.)

Timeline for d5xzra2:

  • d5xzra2 appears in periodic updates to SCOPe 2.06 starting on 2017-12-14