![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Felis catus [TaxId:9685] [342904] (2 PDB entries) |
![]() | Domain d5xmfa2: 5xmf A:183-276 [342905] Other proteins in same PDB: d5xmfa1, d5xmfb_ automated match to d1efxa1 |
PDB Entry: 5xmf (more details), 2.1 Å
SCOPe Domain Sequences for d5xmfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xmfa2 b.1.1.2 (A:183-276) automated matches {Felis catus [TaxId: 9685]} aespntrvtrhpisdrevtlrcwalgfypaeitltwqrdgqdhtqdaelvetrpagdgtf qkwaavvvssgeeqrytchvqheglrepitlrwe
Timeline for d5xmfa2: