Lineage for d5xmfa1 (5xmf A:2-182)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163926Protein automated matches [191280] (4 species)
    not a true protein
  7. 2299601Species Felis catus [TaxId:9685] [342902] (2 PDB entries)
  8. 2299602Domain d5xmfa1: 5xmf A:2-182 [342903]
    Other proteins in same PDB: d5xmfa2, d5xmfb_
    automated match to d1efxa2

Details for d5xmfa1

PDB Entry: 5xmf (more details), 2.1 Å

PDB Description: crystal structure of feline mhc class i for 2,1 angstrom
PDB Compounds: (A:) MHC class I antigen alpha chain

SCOPe Domain Sequences for d5xmfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xmfa1 d.19.1.1 (A:2-182) automated matches {Felis catus [TaxId: 9685]}
gshslryfytavsrpglgeprfiavgyvddtqfvrfdsdapnprmeprapwveqegpeyw
dretrkvkntaqifrvdlntllryynqsesgshniqrmygcdvepdgrllrgynqdsydg
kdyialnedlrswtaadtaaqitgrkweeageaerwrnylqgtcvewlakyldmgketll
r

SCOPe Domain Coordinates for d5xmfa1:

Click to download the PDB-style file with coordinates for d5xmfa1.
(The format of our PDB-style files is described here.)

Timeline for d5xmfa1:

  • d5xmfa1 appears in periodic updates to SCOPe 2.06 starting on 2017-12-14

View in 3D
Domains from same chain:
(mouse over for more information)
d5xmfa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5xmfb_