Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Cat (Felis catus) [TaxId:9685] [342900] (2 PDB entries) |
Domain d5xmmb_: 5xmm B: [342901] Other proteins in same PDB: d5xmma1, d5xmma2 automated match to d1duzb_ |
PDB Entry: 5xmm (more details), 2.9 Å
SCOPe Domain Sequences for d5xmmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xmmb_ b.1.1.2 (B:) beta2-microglobulin {Cat (Felis catus) [TaxId: 9685]} mvqhspkvqvysrhpaengkpnflncyvsgfhppqiditlmkngkkmeaeqtdlsfnrdw tfyllvhteftptvedeyscqvnhttlsepkvvkwdrdm
Timeline for d5xmmb_: