Lineage for d5xmmb_ (5xmm B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2356942Protein beta2-microglobulin [88600] (7 species)
  7. 2356943Species Cat (Felis catus) [TaxId:9685] [342900] (2 PDB entries)
  8. 2356945Domain d5xmmb_: 5xmm B: [342901]
    Other proteins in same PDB: d5xmma1, d5xmma2
    automated match to d1duzb_

Details for d5xmmb_

PDB Entry: 5xmm (more details), 2.9 Å

PDB Description: fla-e*01801-167w/s
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d5xmmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xmmb_ b.1.1.2 (B:) beta2-microglobulin {Cat (Felis catus) [TaxId: 9685]}
mvqhspkvqvysrhpaengkpnflncyvsgfhppqiditlmkngkkmeaeqtdlsfnrdw
tfyllvhteftptvedeyscqvnhttlsepkvvkwdrdm

SCOPe Domain Coordinates for d5xmmb_:

Click to download the PDB-style file with coordinates for d5xmmb_.
(The format of our PDB-style files is described here.)

Timeline for d5xmmb_: