Lineage for d5wt2a_ (5wt2 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (128 species)
    not a true protein
  7. 2472558Species Helicobacter pylori [TaxId:85962] [188666] (5 PDB entries)
  8. 2472565Domain d5wt2a_: 5wt2 A: [342897]
    automated match to d4eb5a_
    complexed with cl, ipa, plp

Details for d5wt2a_

PDB Entry: 5wt2 (more details), 2.3 Å

PDB Description: nifs from helicobacter pylori
PDB Compounds: (A:) Cysteine desulfurase IscS

SCOPe Domain Sequences for d5wt2a_:

Sequence, based on SEQRES records: (download)

>d5wt2a_ c.67.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
vqriyldnnattridpkvkeimdpflrdhygnpsslhqfgtethpaiaealdklykgina
rdiddviitscatesnnwvlkgvyfdeclkkgknhivttvaehpavrstcnfleslgvev
tylpinehgsitaeqvreaitektalvsvmwannetglifpieeigaickekgvlfhtda
vqaigkipvdvlkanadflsfsahkfhgpkgigglyirsgvgltplfhggehmngrrsgt
lnvpyivgmgeamklavehldyekevvgklrdkleeallkipdvmvvgdrihrvpnttlv
svrgiegeamlwdlnrsniaastgsacasedleanpvmvaigaskelahtairlslsrfn
teaeidktievfsqaavr

Sequence, based on observed residues (ATOM records): (download)

>d5wt2a_ c.67.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
vqriyldnnattridpkvkeimdpflrdhygnpsslhqfgtethpaiaealdklykgina
rdiddviitscatesnnwvlkgvyfdeclkkgknhivttvaehpavrstcnfleslgvev
tylpinehgsitaeqvreaitektalvsvmwannetglifpieeigaickekgvlfhtda
vqaigkipvdvlkanadflsfsahkfhgpkgigglyirsgvgltplfhggehmngrrsgt
lnvpyivgmgeamklavehldyekevvgklrdkleeallkipdvmvvgdrihrvpnttlv
svrgiegeamlwdlnrsniaastgsatairlslsrfnteaeidktievfsqaavr

SCOPe Domain Coordinates for d5wt2a_:

Click to download the PDB-style file with coordinates for d5wt2a_.
(The format of our PDB-style files is described here.)

Timeline for d5wt2a_: