Lineage for d5ucoa2 (5uco A:240-394)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2489065Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2489066Protein automated matches [196909] (63 species)
    not a true protein
  7. 2489395Species Hypericum androsaemum [TaxId:140968] [342879] (1 PDB entry)
  8. 2489397Domain d5ucoa2: 5uco A:240-394 [342895]
    automated match to d3wd7a2

Details for d5ucoa2

PDB Entry: 5uco (more details), 2.85 Å

PDB Description: benzophenone synthase from hypericum androsaemum
PDB Compounds: (A:) 2,4,6-trihydroxybenzophenone synthase

SCOPe Domain Sequences for d5ucoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucoa2 c.95.1.0 (A:240-394) automated matches {Hypericum androsaemum [TaxId: 140968]}
vfnilsasqtivpgsdgaitahfyemgmsyflkedviplfrdniaavmeeafsplgvsdw
nslfysihpggrgiidgvagnlgikdenlvatrhvlgeygnmgsacvmfildelrksskv
ngkpttgdgkefgcliglgpgltveavvlqsvpil

SCOPe Domain Coordinates for d5ucoa2:

Click to download the PDB-style file with coordinates for d5ucoa2.
(The format of our PDB-style files is described here.)

Timeline for d5ucoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ucoa1