Lineage for d5bk3f2 (5bk3 F:107-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (765 PDB entries)
  8. 2353510Domain d5bk3f2: 5bk3 F:107-211 [342888]
    Other proteins in same PDB: d5bk3b1, d5bk3d1, d5bk3f1, d5bk3l1
    automated match to d1dn0a2
    complexed with bma, fuc, gol, man, nag, so4

Details for d5bk3f2

PDB Entry: 5bk3 (more details), 2.8 Å

PDB Description: crystal structure of the neutralizing anti-circumsporozoite protein 580 antibody
PDB Compounds: (F:) 580 Antibody, light chain

SCOPe Domain Sequences for d5bk3f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bk3f2 b.1.1.2 (F:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d5bk3f2:

Click to download the PDB-style file with coordinates for d5bk3f2.
(The format of our PDB-style files is described here.)

Timeline for d5bk3f2: