SCOPe 2.08: Domain d5bk3f1: 5bk3 F:1-106

Lineage for d5bk3f1 (5bk3 F:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5bk3f1: 5bk3 F:1-106 [342887]
   Other proteins in same PDB: d5bk3a_, d5bk3b2, d5bk3c_, d5bk3d2, d5bk3e_, d5bk3f2, d5bk3h_, d5bk3l2
   automated match to d1dn0a1
   complexed with gol, so4

Details for d5bk3f1

PDB Entry: 5bk3, 2.8 Å

PDB Description: crystal structure of the neutralizing anti-circumsporozoite protein 580 antibody

PDB Compounds: (F:) 580 Antibody, light chain

SCOPe Domain Sequences for d5bk3f1:

Sequence; same for both SEQRES and ATOM records:

>d5bk3f1 b.1.1.0 (F:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvffssnnrtyfawyqqkpgqppkvliswastr
esgvpdrfsgsgsgtdftltinslqaedvavyfcqqyysspitfgqgtrlei

Timeline for d5bk3f1:

• d5bk3f1 first appeared in SCOPe 2.06
  
• d5bk3f1 appears in SCOPe 2.07