Lineage for d5ucob2 (5uco B:240-394)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2165221Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2165222Protein automated matches [196909] (60 species)
    not a true protein
  7. 2165540Species Hypericum androsaemum [TaxId:140968] [342879] (1 PDB entry)
  8. 2165544Domain d5ucob2: 5uco B:240-394 [342881]
    automated match to d3wd7a2

Details for d5ucob2

PDB Entry: 5uco (more details), 2.85 Å

PDB Description: benzophenone synthase from hypericum androsaemum
PDB Compounds: (B:) 2,4,6-trihydroxybenzophenone synthase

SCOPe Domain Sequences for d5ucob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucob2 c.95.1.0 (B:240-394) automated matches {Hypericum androsaemum [TaxId: 140968]}
vfnilsasqtivpgsdgaitahfyemgmsyflkedviplfrdniaavmeeafsplgvsdw
nslfysihpggrgiidgvagnlgikdenlvatrhvlgeygnmgsacvmfildelrksskv
ngkpttgdgkefgcliglgpgltveavvlqsvpil

SCOPe Domain Coordinates for d5ucob2:

Click to download the PDB-style file with coordinates for d5ucob2.
(The format of our PDB-style files is described here.)

Timeline for d5ucob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ucob1