Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
Protein automated matches [191167] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189384] (17 PDB entries) |
Domain d5whca_: 5whc A: [342871] automated match to d4m5xa_ complexed with ajj, gol |
PDB Entry: 5whc (more details), 2.55 Å
SCOPe Domain Sequences for d5whca_:
Sequence, based on SEQRES records: (download)
>d5whca_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} khtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyelq hsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgkm vsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglqe aekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpany ilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsvr hctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqk
>d5whca_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} khtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyelq hsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgkm vsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglqe aekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpany ilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghctnayml vyiresklsevlqavtdhdipqqlverlqeekrieaqk
Timeline for d5whca_: