Lineage for d5wc4b2 (5wc4 B:230-387)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2489065Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2489066Protein automated matches [196909] (63 species)
    not a true protein
  7. 2489080Species Apple (Malus domestica) [TaxId:3750] [342831] (3 PDB entries)
  8. 2489088Domain d5wc4b2: 5wc4 B:230-387 [342867]
    automated match to d1u0va2
    complexed with bu4, byc

Details for d5wc4b2

PDB Entry: 5wc4 (more details), 1.2 Å

PDB Description: crystal structure of biphenyl synthase from malus domestic complexed with benzoyl-coa
PDB Compounds: (B:) BIS3 biphenyl synthase

SCOPe Domain Sequences for d5wc4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wc4b2 c.95.1.0 (B:230-387) automated matches {Apple (Malus domestica) [TaxId: 3750]}
plfeivacrqtilpnsehgvvaniremgfnyylsgdvpkfvggnvvdfmtktfekvdgkk
kdwnslffsvhpggpaivdqveeklglkegklratrhvlseygnmgaptvhfildemrnk
sieegktttgeglewgvvigigpgltvetavlrsesir

SCOPe Domain Coordinates for d5wc4b2:

Click to download the PDB-style file with coordinates for d5wc4b2.
(The format of our PDB-style files is described here.)

Timeline for d5wc4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5wc4b1