Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Malus domestica [TaxId:3750] [342831] (3 PDB entries) |
Domain d5wc4a1: 5wc4 A:10-229 [342853] automated match to d1u0va1 complexed with bu4, byc |
PDB Entry: 5wc4 (more details), 1.2 Å
SCOPe Domain Sequences for d5wc4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wc4a1 c.95.1.0 (A:10-229) automated matches {Malus domestica [TaxId: 3750]} qhakilaigtanppnvyhqkdypdflfrvtknehrtdlrekfdriceksrtkkrylhlte emlkanpniytygapsldvrqdicnievpklgqeaalkaikewgqpisrithlifctasc vdmpgcdfqlikllgldpsvtrtmiyeagcyagatvlrmakdfaennkgarvlvvcaeit tvffhgltdthldilvgqalfadgasavivganpepeier
Timeline for d5wc4a1: