Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins) contains many insertions in the common fold automatically mapped to Pfam PF00840 |
Protein automated matches [190170] (17 species) not a true protein |
Species Myceliophthora thermophila [TaxId:78579] [342842] (1 PDB entry) |
Domain d5w11b_: 5w11 B: [342843] automated match to d1cela_ complexed with 144, ctr, man, nag |
PDB Entry: 5w11 (more details), 2.31 Å
SCOPe Domain Sequences for d5w11b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w11b_ b.29.1.10 (B:) automated matches {Myceliophthora thermophila [TaxId: 78579]} enactltaenhpsltwskctsggsctsvqgsitidanwrwthrtdsatncyegnkwdtsy csdgpscaskccidgadysstygittsgnslnlkfvtkgqystnigsrtylmesdtkyqm fqllgneftfdvdvsnlgcglngalyfvsmdadggmskysgnkagakygtgycdsqcprd lkfingeanvenwqsstndanagtgkygsccsemdvweannmaaaftphpctvigqsrce gdscggtystdryagicdpdgcdfnsyrqgnktfygkgmtvdttkkitvvtqflknsage lseikrfyvqngkvipnsestipgvegnsitqdwcdrqkaafgdvtdfqdkggmvqmgka lagpmvlvmsiwddhavnmlwldstwpidgagkpgaergacpttsgvpaeveaeapnsnv ifsnirfgpigstvsglpdg
Timeline for d5w11b_: