Lineage for d5njjc_ (5njj C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071257Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2071299Protein Numb [50762] (3 species)
  7. 2071303Species Homo sapiens [TaxId:9606] [342799] (1 PDB entry)
  8. 2071305Domain d5njjc_: 5njj C: [342807]
    automated match to d2nmba_
    complexed with so4

Details for d5njjc_

PDB Entry: 5njj (more details), 2.7 Å

PDB Description: ptb domain of human numb isoform-1
PDB Compounds: (C:) Protein numb homolog

SCOPe Domain Sequences for d5njjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5njjc_ b.55.1.2 (C:) Numb {Homo sapiens [TaxId: 9606]}
deegvrtgkcsfpvkylghvevdesrgmhicedavkrlkaerkffkgffgktgkkavkav
lwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfmav
kdtgerlshavgcafaacler

SCOPe Domain Coordinates for d5njjc_:

Click to download the PDB-style file with coordinates for d5njjc_.
(The format of our PDB-style files is described here.)

Timeline for d5njjc_: