Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (31 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [342789] (1 PDB entry) |
Domain d5n0ka1: 5n0k A:1-191 [342790] automated match to d1kcwa1 complexed with ca, cu, na, nag |
PDB Entry: 5n0k (more details), 2.3 Å
SCOPe Domain Sequences for d5n0ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n0ka1 b.6.1.0 (A:1-191) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rekhyyigiteavwdyasgseekelisvdteqsnfylrngpdrigrkykkalyseytdgt ftktidkpawlgllgpvikaevgdkvsvhvknfasrpytfhahgvtytkanegaiypdnt tdfqraddklfpgqqylyvlranepspgegdsncvtriyhshvdapkdiasgligplilc kkgslhkekee
Timeline for d5n0ka1: