SCOPe 2.08: Domain d5k28b1: 5k28 B:43-102

Lineage for d5k28b1 (5k28 B:43-102)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)

8. Domain d5k28b1: 5k28 B:43-102 [342780]
   Other proteins in same PDB: d5k28a2, d5k28b2
   automated match to d2rf0d_

Details for d5k28b1

PDB Entry: 5k28, 1.5 Å

PDB Description: structure of the unbound sh3 domain of mlk3

PDB Compounds: (B:) Mitogen-activated protein kinase kinase kinase 11

SCOPe Domain Sequences for d5k28b1:

Sequence; same for both SEQRES and ATOM records:

>d5k28b1 b.34.2.0 (B:43-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvwtalfdyepsgqdelalrkgdrvevlsrdaaisgdegwwagqvggqvgifpsnyvsrg

Timeline for d5k28b1:

• d5k28b1 first appeared in SCOPe 2.06
  
• d5k28b1 appears in SCOPe 2.07