Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
Superfamily d.126.1: Pentein [55909] (8 families) |
Family d.126.1.0: automated matches [191334] (1 protein) not a true family |
Protein automated matches [190175] (10 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [342731] (2 PDB entries) |
Domain d6b2wa1: 6b2w A:1-325 [342766] Other proteins in same PDB: d6b2wa2, d6b2wb2 automated match to d1zbra1 complexed with ag2, k |
PDB Entry: 6b2w (more details), 2.5 Å
SCOPe Domain Sequences for d6b2wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b2wa1 d.126.1.0 (A:1-325) automated matches {Campylobacter jejuni [TaxId: 192222]} miksipewseqeylmlslpheksdwnpyleeilqsykefvkvvsefqkvlliapkqsdfe nfkdiknveffkcdtndtwirdfgaidivengrlkaldftfnawgnkfqseldnavnskl fkekfkeelkkvdfileggsidfngegvmltsshcllnenrnshlnktqidtklkeifgl kqiiwlengfikgddtdhhidtlarfidkntiahcicedeedehylplqkmkeelkktgf dllelpipkplyyeerrlgatyanfvfinnalivpfykdkndeiiakrlskalpnhkiig vdarvflrqngslhsscqnrfkglr
Timeline for d6b2wa1: