Lineage for d6b2wa1 (6b2w A:1-325)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2580827Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2580828Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2580977Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2580978Protein automated matches [190175] (10 species)
    not a true protein
  7. 2580979Species Campylobacter jejuni [TaxId:192222] [342731] (2 PDB entries)
  8. 2580982Domain d6b2wa1: 6b2w A:1-325 [342766]
    Other proteins in same PDB: d6b2wa2, d6b2wb2
    automated match to d1zbra1
    complexed with ag2, k

Details for d6b2wa1

PDB Entry: 6b2w (more details), 2.5 Å

PDB Description: c. jejuni c315s agmatine deiminase with substrate bound
PDB Compounds: (A:) Putative peptidyl-arginine deiminase family protein

SCOPe Domain Sequences for d6b2wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b2wa1 d.126.1.0 (A:1-325) automated matches {Campylobacter jejuni [TaxId: 192222]}
miksipewseqeylmlslpheksdwnpyleeilqsykefvkvvsefqkvlliapkqsdfe
nfkdiknveffkcdtndtwirdfgaidivengrlkaldftfnawgnkfqseldnavnskl
fkekfkeelkkvdfileggsidfngegvmltsshcllnenrnshlnktqidtklkeifgl
kqiiwlengfikgddtdhhidtlarfidkntiahcicedeedehylplqkmkeelkktgf
dllelpipkplyyeerrlgatyanfvfinnalivpfykdkndeiiakrlskalpnhkiig
vdarvflrqngslhsscqnrfkglr

SCOPe Domain Coordinates for d6b2wa1:

Click to download the PDB-style file with coordinates for d6b2wa1.
(The format of our PDB-style files is described here.)

Timeline for d6b2wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b2wa2