Lineage for d6bc0f_ (6bc0 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867786Protein RhoA [52612] (1 species)
  7. 2867787Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
    Uniprot P61586 2-181
  8. 2867823Domain d6bc0f_: 6bc0 F: [342750]
    automated match to d4f38a_
    complexed with gsp, mg

Details for d6bc0f_

PDB Entry: 6bc0 (more details), 2.2 Å

PDB Description: a complex between ph domain of p190rhogef and activated rhoa bound to a gtp analog
PDB Compounds: (F:) transforming protein rhoa

SCOPe Domain Sequences for d6bc0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bc0f_ c.37.1.8 (F:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

SCOPe Domain Coordinates for d6bc0f_:

Click to download the PDB-style file with coordinates for d6bc0f_.
(The format of our PDB-style files is described here.)

Timeline for d6bc0f_: