Lineage for d5h7of2 (5h7o F:77-378)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541719Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 protein domains)
    Pfam PF03133; PubMed 22020298
  6. 2541720Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)
  7. 2541721Species Chicken (Gallus gallus) [TaxId:9031] [311385] (74 PDB entries)
  8. 2541775Domain d5h7of2: 5h7o F:77-378 [342742]
    Other proteins in same PDB: d5h7oa1, d5h7oa2, d5h7ob1, d5h7ob2, d5h7oc1, d5h7oc2, d5h7od1, d5h7od2, d5h7oe_, d5h7of1, d5h7of3
    automated match to d3tiia2
    complexed with 7q7, acp, ca, gdp, gol, gtp, mes, mg

Details for d5h7of2

PDB Entry: 5h7o (more details), 2.8 Å

PDB Description: crystal structure of dj-101 in complex with tubulin protein
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5h7of2:

Sequence, based on SEQRES records: (download)

>d5h7of2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5h7of2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwialisseasel
ldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepyn
sanfqdktchltnhciqknygryeegnemffeefnqylmdalnttlensillqikhiirs
clmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdv
aissvfplatsifikl

SCOPe Domain Coordinates for d5h7of2:

Click to download the PDB-style file with coordinates for d5h7of2.
(The format of our PDB-style files is described here.)

Timeline for d5h7of2: