SCOPe 2.06: Domain d5h7od1: 5h7o D:1-243

Lineage for d5h7od1 (5h7o D:1-243)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries)

8. Domain d5h7od1: 5h7o D:1-243 [342735]
   Other proteins in same PDB: d5h7oa2, d5h7ob2, d5h7oc2, d5h7od2, d5h7oe_, d5h7of1, d5h7of2, d5h7of3
   automated match to d4drxb1
   complexed with 7q7, acp, ca, gdp, gol, gtp, mes, mg

Details for d5h7od1

PDB Entry: 5h7o, 2.8 Å

PDB Description: crystal structure of dj-101 in complex with tubulin protein

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5h7od1:

Sequence; same for both SEQRES and ATOM records:

>d5h7od1 c.32.1.1 (D:1-243) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d5h7od1:

• d5h7od1 is new in SCOPe 2.06-stable
  
• d5h7od1 appears in SCOPe 2.07
  
• d5h7od1 appears in the current release, SCOPe 2.08