Lineage for d6bcbf_ (6bcb F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125676Species Mouse (Mus musculus) [TaxId:10090] [186896] (17 PDB entries)
  8. 2125682Domain d6bcbf_: 6bcb F: [342720]
    automated match to d4f38a_
    complexed with edo, gsp, mg

Details for d6bcbf_

PDB Entry: 6bcb (more details), 1.4 Å

PDB Description: a complex between ph domain of p114rhogef and activated rhoa bound to a gtp analog
PDB Compounds: (F:) transforming protein rhoa

SCOPe Domain Sequences for d6bcbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bcbf_ c.37.1.8 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
a

SCOPe Domain Coordinates for d6bcbf_:

Click to download the PDB-style file with coordinates for d6bcbf_.
(The format of our PDB-style files is described here.)

Timeline for d6bcbf_: